Bacterial taxon 243277
Locus VC_2051
Protein NP_231683.1
thiol:disulfide interchange protein DsbE
Vibrio cholerae O1 biovar El Tor str. N16961
Length 184 aa, Gene dsbE, UniProt Q9KQE9
>NP_231683.1|Vibrio cholerae O1 biovar El Tor str. N16961|thiol:disulfide interchange protein DsbE
MNKKILFIPLVAFLLLAGVFATQLMKNSAGDDPTKLESVLVGKTVPEFRLEDLAEPGKLYDQSIFKGEPLLLNVWATWCPTCYAEHQYLNELAKQGVKIIGLNYKDQRDKATQWLNDLGNPYLISLFDGNGMLGLDLGVYGAPETFLIDANGVIRYRHVGDVNSRNWQETLAPLYEKMLAEAKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.51 | 4.8e-7 | ●●●○○ -2.14 | -2.136207907553558 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)