Bacterial taxon 243277
Locus VC_1226
Protein NP_230871.1
thiopurine S-methyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 218 aa, Gene tpm, UniProt Q9KSN0
>NP_230871.1|Vibrio cholerae O1 biovar El Tor str. N16961|thiopurine S-methyltransferase
MRDPEFWHNKWAANQIGFHLEDVNPLLIRFWSDLAPKRSEKVLVPLCGKSEDLIWLANQHDSVQGVELSQIAVRSFFAEHFYTPTVTRLNAQHELYQFDELTLFTGDFFTAPVESVDLVYDRAALVALPEEMRAEYAQRVLQLLKPGGRILLVSMDYVQTELSGPPFSVPEAEIRTLFMGCEVRRVYQDTSIDPHLNKRTQAGLSRFAEEVWVIEKSE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.36 | 0.00023 | ○○○○○ 1.03 | 1.0307815820616228 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)