Bacterial taxon 243277
Locus VC_2160
Protein NP_231791.1
thioredoxin-dependent thiol peroxidase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 155 aa, Gene n/a, UniProt Q9KQ44
>NP_231791.1|Vibrio cholerae O1 biovar El Tor str. N16961|thioredoxin-dependent thiol peroxidase
MNTLTAGTPAPAFSLPDQNGNPVTLADFAGKKVLLYFYPKAMTPGCTVQAQGLRDIQAELQGHNVVVLGVSTDPVKRLGKFIERDNLNFSLLSDEDHQVAEQFGVWGEKKFMGKVFDGLHRISFLINEQGVIEQVFDKFKTSNHHEVVLAYLSGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.81 | 0.0034 | ●○○○○ -0.43 | -0.43160771864659886 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)