Bacterial taxon 243277
Locus VC_0100
Protein NP_229759.1
thiosulfate sulfurtransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 106 aa, Gene glpE, UniProt Q9KVP1
>NP_229759.1|Vibrio cholerae O1 biovar El Tor str. N16961|thiosulfate sulfurtransferase
MDHFLHIDVNAAQAMMEQKQAHLVDIRDPQSFQLAHAKNAYHLTNQSMVQFMEQAEFDQPVLVMCYHGISSQGAAQYLVNQGFEEVYSVDGGFEAWHRANLPIEAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.72 | 0.0035 | ○○○○○ 0.74 | 0.7369830847574665 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)