Bacterial taxon 243277
Locus VC_1167
Protein NP_230812.1
thymidine kinase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 192 aa, Gene tdk, UniProt Q9KST9
>NP_230812.1|Vibrio cholerae O1 biovar El Tor str. N16961|thymidine kinase
MAQMYFYYSAMNAGKSTTLLQSAFNYQERGMNPLIFTAAIDDRFGVGKVSSRIGLEAEAHLFHADTDLLHVIATLHEAEPRHCILMDECQFLSKEQVYQLTEVVDKLDIPVLCYGLRTDFLGELFEGSKYLLSWADKLIELKTICHCGRKANMVIRTDEHGNAISEGDQVAIGGNDKYVSVCRQHYKEALGR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2 | 6.1e-5 | ●○○○○ -0.52 | -0.5174121655631942 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)