Bacterial taxon 243277
Locus VC_A0911
Protein NP_233296.1
TonB system transport protein ExbB1
Vibrio cholerae O1 biovar El Tor str. N16961
Length 228 aa, Gene exbB1, UniProt O52043
>NP_233296.1|Vibrio cholerae O1 biovar El Tor str. N16961|TonB system transport protein ExbB1
MESLQQLQQQLGLMAWPLFICSALTVMLLAERLFQVLLSLTVGKGAIRHALQATSPKNPKQLAELTEHFASKRPVLYRGVAMLLAHHQFDKSLREDAAGIWLQEQRHQFNSGLRLLTLIGVISPLLGLLGTVLGLIEMFKGVAATTGSITPNVLADGLGVAMYTTAAGLLIAVPAVAGAQLLSLWADRTMAKLEHTLNYVNLWLEGMTLHADASLTVVTPQEATTENL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.92 | 0.0011 | ○○○○○ 0.95 | 0.9545110608430322 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)