Bacterial taxon 243277
Locus VC_0830
Protein NP_230478.1
toxin co-regulated pilus biosynthesis protein Q
Vibrio cholerae O1 biovar El Tor str. N16961
Length 150 aa, Gene tcpQ, UniProt P29490
>NP_230478.1|Vibrio cholerae O1 biovar El Tor str. N16961|toxin co-regulated pilus biosynthesis protein Q
MKKNYYIGACIALILSGPTFAQGEMHNTNEQIAEQSSVDLIAEIYHSDRYAETFVESEQFEQEESTSKEPILFVTPYDQLKDKLESWADLHGYVVKWNTQKTVQFDNAVAYEGDFEQVLTELASDINQIGIDINFKIFQKNKVIVVYSVR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -8.69 | 1.7e-8 | ●●●●○ -3.6 | -3.6043848275930226 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)