Bacterial taxon 243277 
						  Locus VC_0830 
						  Protein NP_230478.1 
					
				
				toxin co-regulated pilus biosynthesis protein Q
				Vibrio cholerae O1 biovar El Tor str. N16961 
				Length 150 aa, Gene tcpQ, UniProt P29490 
					
				
				
					>NP_230478.1|Vibrio cholerae O1 biovar El Tor str. N16961|toxin co-regulated pilus biosynthesis protein Q
MKKNYYIGACIALILSGPTFAQGEMHNTNEQIAEQSSVDLIAEIYHSDRYAETFVESEQFEQEESTSKEPILFVTPYDQLKDKLESWADLHGYVVKWNTQKTVQFDNAVAYEGDFEQVLTELASDINQIGIDINFKIFQKNKVIVVYSVR
				
				 
				
			
		    
            
              
            	| Host | Tissue | Tissue Ontology | Time Post Infection | Transposon Insertion Site | Raw Fitness Score | p-Value | Fitness z-Score | Precise fitness z-Score | Reference | 
            
            
            
            | Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -8.69 | 1.7e-8 | ●●●●○ -3.6 | -3.6043848275930226 | 24331463 | 
              
          
		   Retrieved 1 of 1 entries in 1.9 ms
			  (Link to these results)