Bacterial taxon 243277
Locus VC_0832
Protein NP_230480.1
toxin co-regulated pilus biosynthesis protein R
Vibrio cholerae O1 biovar El Tor str. N16961
Length 151 aa, Gene tcpR, UniProt P0C6D5
>NP_230480.1|Vibrio cholerae O1 biovar El Tor str. N16961|toxin co-regulated pilus biosynthesis protein R
MTSIWLHESDFRYVNLDVERYQKKYRLTLTNGNKYVFIKDKEDISDVNPFIPYILMEEGMNNVLVKSDDYKDILIYQGVNIQCLDFLNDNDISVEKLVDFETVELKADELNKIKARRLDAQLIEDEVKNNKVFIIGFIAIVIISIGVFWLM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.32 | 7.5e-11 | ●●●○○ -2.51 | -2.509557635865599 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)