Bacterial taxon 243277
Locus VC_A0387
Protein NP_232781.1
toxin resistance protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 169 aa, Gene n/a, UniProt Q9KMG9
>NP_232781.1|Vibrio cholerae O1 biovar El Tor str. N16961|toxin resistance protein
MEIXTGEFEDIAGITDIFNFYIEQTNARFEEFPFTLENREEWFSQFSRTAKYQIYVAVENGVLQGFACSQKYRAIPAFDDTVEVSVYLAQEAKGKGLGSKLYTQLFSSIRAYGVHRILSGVALPNDASVALHKRFGFREVGISNEYAKKHGQYISSLWLEKALNVESAL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.92 | 1.7e-5 | ●●●○○ -2.15 | -2.1544499241757364 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)