Bacterial taxon 243277
Locus VC_2715
Protein NP_232342.1
transcription elongation factor GreB
Vibrio cholerae O1 biovar El Tor str. N16961
Length 161 aa, Gene greB, UniProt Q9KNL7
>NP_232342.1|Vibrio cholerae O1 biovar El Tor str. N16961|transcription elongation factor GreB
MKTKLITRAGYNKLKQELDYLWKEQRPEITQKVSWAASLGDRSENADYTYNKRLLRQIDRRVRFLSKLLPELKIVDYSPQQEGKVFFGAWVEIENEAGEVKKFRIVGPEEIYGDAKDYISIDSPMARALLKKQVDEEFQVHTPTGIKEWFINSIEYEKGEL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.91 | 0.00059 | ○○○○○ 0.83 | 0.8257354938273561 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)