Bacterial taxon 243277
Locus VC_2301
Protein NP_231932.1
transcriptional activator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 226 aa, Gene n/a, UniProt Q9KPR5
>NP_231932.1|Vibrio cholerae O1 biovar El Tor str. N16961|transcriptional activator
MSYHPNYALLAAYAEGGLDSAHGLAISAHLEICPHCRDLVHEIEAELGELLNQQAASSVALSDDANWQAMFDSIVALPQQAASNTPVKTTPVMVTVNGKQIAIPKVLARLVKPEQQWRSYGGKVFSLPLQSEDNVRMNLMYISQGVSIPQHTHKGFESTLVLHGGFSDENGHYDVGDFMQHDGQICHSPSTPQDQDCLCLTVLTEPMVFTQGVARIFNLFGKGLYP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.71 | 0.0021 | ○○○○○ 0.08 | 0.07670805664543388 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)