Bacterial taxon 243277
Locus VC_0678
Protein NP_230327.1
transcriptional activator HlyU
Vibrio cholerae O1 biovar El Tor str. N16961
Length 108 aa, Gene hlyU, UniProt P52695
>NP_230327.1|Vibrio cholerae O1 biovar El Tor str. N16961|transcriptional activator HlyU
MPYLKGAPMNLQEMEKNSAKAVVLLKAMANERRLQILCMLLDNELSVGELSSRLELSQSALSQHLAWLRRDGLVNTRKEAQTVFYTLSSTEVKAMIELLHRLYCQANQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.77 | 1.1e-5 | ○○○○○ 0.76 | 0.7593951866747012 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)