Bacterial taxon 243277
Locus VC_0814
Protein NP_230463.1
transcriptional regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 159 aa, Gene n/a, UniProt Q9KTS4
>NP_230463.1|Vibrio cholerae O1 biovar El Tor str. N16961|transcriptional regulator
MGATMKPSNKESVQDTVARLRENRNQQQSKVGKNATHSSKEQTPLDTPTRSKASKNAKAVSAAERKTEANKIIKHLLLGELTQGQALKSLRINILGLKQDVFARLVDVSRKTLSDIENDRGSYNTEILNKVFKPFSLKIGLLPSSPDALKSLLMDGEDG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.76 | 3.8e-8 | ●●○○○ -1.79 | -1.7906548971232046 | 24331463 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)