Bacterial taxon 243277
Locus VC_0727
Protein NP_230376.1
transcriptional regulator PhoU
Vibrio cholerae O1 biovar El Tor str. N16961
Length 236 aa, Gene n/a, UniProt Q9KU03
>NP_230376.1|Vibrio cholerae O1 biovar El Tor str. N16961|transcriptional regulator PhoU
MQFGRHISGQFNVELESIRSQVLTMGGLVEQQLTLAMQALHEDDEKLARRVIADDHKVNAMEVSIDEACTRIIAKRQPTAKDLRLIMAIIKTITDLERIGDSATKMAYIAIERPPAKQHQFQVSLEPLCRQAIAMLHQVLDAFARMDVEAAAEIYKQDDRLDKEYEAVVRQLMTYMMEDPKNIPHILQVIWSARAIERVGDRCQNICEYIIYFVKGKDVRHLGDQGIDDVLKKPSL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.26 | 4.2e-6 | ●●●○○ -2.02 | -2.022533050841014 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)