Bacterial taxon 243277
Locus VC_A0682
Protein NP_233070.1
transcriptional regulator UhpA
Vibrio cholerae O1 biovar El Tor str. N16961
Length 208 aa, Gene n/a, UniProt Q9KLR0
>NP_233070.1|Vibrio cholerae O1 biovar El Tor str. N16961|transcriptional regulator UhpA
MITIALVDDHTIVRSGFAQLLNLEQDIRVQGEYESAKAAFYALTQAEVDVAIIDISMPDENGLSLLERLRQHNPRFKAIILSIYDSASFVKKALDAGAQGYLSKRCGPSELVSAIRTVASGRRYLCADALVNLSNPDINNVLADLTKREVEVFDLLVQGKEVKEIAQTLFLSHKTVHVHRANILSKLNLTNNVDVIRFALQHQLLVEG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.53 | 3.4e-7 | ●○○○○ -0.62 | -0.6196898027176183 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)