Bacterial taxon 243277
Locus VC_2682
Protein NP_232310.1
transcriptional repressor protein MetJ
Vibrio cholerae O1 biovar El Tor str. N16961
Length 105 aa, Gene metJ, UniProt Q9KNP9
>NP_232310.1|Vibrio cholerae O1 biovar El Tor str. N16961|transcriptional repressor protein MetJ
MADWNGEYISPYAEHGKKSELVKKITVSIPLKVLKVLTDERTRRQVNNLRHATNSELLCEAFLHAYTGQPLPTDEDLRKDRPDDIPAEAKRLMTEMGIEFESYDE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.67 | 0.001 | ●○○○○ -0.36 | -0.36379171476125277 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)