Bacterial taxon 243277
Locus VC_A0507
Protein NP_232898.1
transposase OrfAB subunit A
Vibrio cholerae O1 biovar El Tor str. N16961
Length 114 aa, Gene n/a, UniProt Q9K344
>NP_232898.1|Vibrio cholerae O1 biovar El Tor str. N16961|transposase OrfAB subunit A
MISSPHKLTGDIMTKRTRRLFSAEFKLEAAQLVLDQNYSVTEAAQAMNVGKSTMDKWVRQLREERQGKTPKASPMTPEQIEIRELKKKLARLEEHNEILKKATALLMSDSLNNS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.37 | 0.0006 | ●○○○○ -0.51 | -0.513143444808135 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)