Bacterial taxon 243277
Locus VC_A0792
Protein NP_233178.1
transposase OrfAB subunit A
Vibrio cholerae O1 biovar El Tor str. N16961
Length 114 aa, Gene n/a, UniProt Q9K344
>NP_233178.1|Vibrio cholerae O1 biovar El Tor str. N16961|transposase OrfAB subunit A
MISSPHKLTGDIMTKRTRRLFSAEFKLEAAQLVLDQNYSVTEAAQAMNVGKSTMDKWVRQLREERQGKTPKASPMTPEQIEIRELKKKLARLEEHNEILKKATALLMSDSLNNS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.24 | 0.033 | ○○○○○ 0.52 | 0.5172336237342783 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)