Bacterial taxon 243277
Locus VC_0888
Protein NP_230535.1
tRNA pseudouridine synthase C
Vibrio cholerae O1 biovar El Tor str. N16961
Length 244 aa, Gene truC, UniProt Q9KTL4
>NP_230535.1|Vibrio cholerae O1 biovar El Tor str. N16961|tRNA pseudouridine synthase C
MLEIVYQDEYLVAVNKPAGMLVHRSWLDKHETEFVMQTLRDQIGQHVFPLHRLDRPTSGVLVFALSSQIASEVMPMFANHEMEKTYHAIVRGWIEEANVLDYPLKEELDKIADKFAKQDKEAQSAVTAYRPLAKVELPIATGKFATTRYCLMEMQPKTGRKHQLRRHMAHLRHPIVGDTTHGDGVHNRLFREHFSAQRLMLHASELRFMHPYTQQPLVIRAGLDEVWQGLLSEFGWQESLLINA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.52 | 0.043 | ○○○○○ 0.17 | 0.16641539480215722 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)