Bacterial taxon 243277
Locus VC_1169
Protein NP_230814.1
tryptophan synthase subunit alpha
Vibrio cholerae O1 biovar El Tor str. N16961
Length 268 aa, Gene trpA, UniProt Q9KST7
>NP_230814.1|Vibrio cholerae O1 biovar El Tor str. N16961|tryptophan synthase subunit alpha
MNRYQALFQRLSAAQQGAFVPFVTIGDPNPEQSLAIMQTLIDAGADALELGMPFSDPLADGPTIQGANLRALAAKTTPDICFELIAQIRARNPETPIGLLMYANLVYARGIDDFYQRCQKAGVDSVLIADVPTNESQPFVAAAEKFGIQPIFIAPPTASDETLRAVAQLGKGYTYLLSRAGVTGAETKANMPVHALLERLQQFDAPPALLGFGISEPAQVKQAIEAGAAGAISGSAVVKIIETHLDNPAKQLTELANFTQAMKKATKI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.56 | 0.0052 | ○○○○○ 0.15 | 0.14830214164486052 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)