Bacterial taxon 243277
Locus VC_0858
Protein NP_230505.1
type IV pilin
Vibrio cholerae O1 biovar El Tor str. N16961
Length 184 aa, Gene n/a, UniProt Q9KTP3
>NP_230505.1|Vibrio cholerae O1 biovar El Tor str. N16961|type IV pilin
MIHHPLTVCKGFWEMHRGFTLLELLITVAVLTTMLLFAAPNFSKVSQQTKMTNLANELQGFLIQAKSEAVFRNQDLWVHIQGLPSITGQWQLVLSSVSDVAAIDASNTVALLQGQRYQNVFVSKTNTLTEVKFDHVMGNPQEAGSLFIKPSESAADSIKVTVHNRAGRIKVCTENEAKYGFEKC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.24 | 4.3e-8 | ●○○○○ -0.63 | -0.6297156096025943 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)