Bacterial taxon 243277
Locus VC_0573
Protein NP_230224.1
ubiquinol--cytochrome c reductase iron-sulfur subunit
Vibrio cholerae O1 biovar El Tor str. N16961
Length 197 aa, Gene n/a, UniProt Q9KUE8
>NP_230224.1|Vibrio cholerae O1 biovar El Tor str. N16961|ubiquinol--cytochrome c reductase iron-sulfur subunit
MSNAPLNQGRRRFLTATTAVVGGLGAVAVAVPFIKSWNPSAKAKAAGAPVEVEISKLEEGQMVRVEWRGKPVWVVRRSQAVVEGLKSHENQLRDPNSDELQQPNYAQNPYRSIKPEYFIAVGICTHLGCSPTYLPDSFSEQVQGVKSGFFCPCHGSKFDMAGRVFQAVPAPLNLVIPPHMYLSDTRIVIGLDETGEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.53 | 0.012 | ○○○○○ 0.65 | 0.6511717585458732 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)