Bacterial taxon 243277
Locus VC_0083
Protein NP_229742.1
ubiquinone/menaquinone biosynthesis methyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 260 aa, Gene ubiE, UniProt Q9KVQ6
>NP_229742.1|Vibrio cholerae O1 biovar El Tor str. N16961|ubiquinone/menaquinone biosynthesis methyltransferase
MTDTNVLANSATDNQETTHFGFETVRKDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARPGQRILDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDSGVVGNVHYVQANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPILEPLSKLYDTYSFHILPKMGQLIANDADSYRYLAESIRMHPDQETLKGMMEEAGFEQTTYYNLTGGIVALHRGYKF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -8.13 | 4.1e-13 | ●●●●○ -3.34 | -3.3442734261982965 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)