Bacterial taxon 243277
Locus VC_0262
Protein NP_229918.1
UDP-glucose 4-epimerase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 323 aa, Gene n/a, UniProt Q9KV94
>NP_229918.1|Vibrio cholerae O1 biovar El Tor str. N16961|UDP-glucose 4-epimerase
MEPDNQTPLKILVTGASGFVGLRVLTQAQNIGYALVAQSRSQQPYSFEQVLLDITPNTDWERALVGVDCVVHCAARVHQMQETEADALKAYRDVNTQGTLNLAKQAVSAGVKRFIFLSSIKVNGEQTKAGSAFQHDDQHIPSDPYGLSKYEAEQQLLELAAETGLEVVIIRPPLVYGEGVKANFLSMMNWVKKQIPLPLGAVGNMRSLVYLDNLVDLILVCCQHPKAAGEIFLVSDNHDVSLTTLLRTIAQAMQIRPRLLPIPQTGLQWLLRLLGKPELGQRLCGNLQLDIAHTQKTLHWSPPVSFEQGIARTVNFYLSQSSK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.97 | 0.0014 | ●○○○○ -0.04 | -0.043619896989158954 | 24331463 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)