Bacterial taxon 243277
Locus VC_0076
Protein NP_229735.1
universal stress protein A
Vibrio cholerae O1 biovar El Tor str. N16961
Length 141 aa, Gene n/a, UniProt Q9KVR3
>NP_229735.1|Vibrio cholerae O1 biovar El Tor str. N16961|universal stress protein A
MSYQHLLVAVDLSEDSKLLVEKAVALAKPLNAEVSFIHIDVNYAELYTGLIDINLAETQHHAMEASQKQLQDLAQHANYPIKHTLVGSGDLTNELCETISEFNVDLLVCGHHQDFWSKLLSSTRQLINSSPVDMLVIPLND
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.21 | 6.5e-6 | ●○○○○ -0.15 | -0.15302700516941217 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)