Bacterial taxon 243277
Locus VC_2359
Protein NP_231989.1
uracil-DNA glycosylase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 226 aa, Gene ung, UniProt Q9KPK8
>NP_231989.1|Vibrio cholerae O1 biovar El Tor str. N16961|uracil-DNA glycosylase
MSESLTWHDVIGNEKQQAYFQQTLQFVESQRQAGKVIYPPAKDVFNAFRFTEFGDVKVVILGQDPYHGPNQAHGLCFSVLPGVKTPPSLVNIYKELAQDIPGFQIPPHGYLQSWAQQGVLLLNTVLTVEQGMAHSHANTGWETFTDRVIDALNQHRNGLIFLLWGSHAQKKGQMIDRQRHHVLMAPHPSPLSAHRGFLGCRHFSKTNQLLQAQGIAPINWQPELES
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.6 | 0.00033 | ●○○○○ -0.33 | -0.33132952762530093 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)