Bacterial taxon 243277
Locus VC_2429
Protein NP_232059.1
zinc-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 65 aa, Gene yacG, UniProt Q9KPE1
>NP_232059.1|Vibrio cholerae O1 biovar El Tor str. N16961|zinc-binding protein
MTKKLTIVKCPRCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAPDMSDSDGWSEDQY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.76 | 3.2e-8 | ●●○○○ -1.33 | -1.3279198316565834 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)