Bacterial taxon 223926
Locus VP_0466
Protein BAC58729.1
conserved hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 151 aa, Gene n/a, UniProt Q87SF8
>BAC58729.1|Vibrio parahaemolyticus RIMD 2210633|conserved hypothetical protein
MRDHRPTSTEDVIAESQFKQVQEHAGEILQLNQALQTILPKGTADHCRVANIRNGHLLIDVSSAAIKMKIDYDRLMILNKLRTQGYAKLISVDVRINPSLYRNRYEKDDRPKRPPLTESAAQSLMTIADMAPPKIQERLKRLADMAEKSSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.17 | 0.0014 | ●●●●○ -3.33 | -3.326597871374416 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)