Bacterial taxon 223926
Locus VP_0645
Protein BAC58908.1
conserved hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 147 aa, Gene n/a, UniProt Q87RY1
>BAC58908.1|Vibrio parahaemolyticus RIMD 2210633|conserved hypothetical protein
MKQVSRSALVSFSAEQMFNLVNDVAKYPEFLPGCSGSRIIESSGNGMVASVDVAKAGISKTFTTSNELIPGQAIMMNLVDGPFKTLRGGWIFTALDEQACKVELKLEFEFSSKMIEMAFGKIFNELTSNMVNAFTKRAKQVYECYEY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.86 | 0.0032 | ●●●●○ -3.06 | -3.0606250939037554 | 27185914 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)