Bacterial taxon 223926
Locus VP_1048
Protein BAC59311.1
crossover junction endodeoxyribonuclease RuvC
Vibrio parahaemolyticus RIMD 2210633
Length 173 aa, Gene ruvC, UniProt Q87QV1
>BAC59311.1|Vibrio parahaemolyticus RIMD 2210633|crossover junction endodeoxyribonuclease RuvC
MSIILGIDPGSRITGYGVIRQQGRHLQYLGSGCIRTSEKELPGRLKQIYAGVTEIITQFQPDVFAIEQVFMAKNADSALKLGQARGSAIVAAVNADLPVYEYAARLIKQAVVGTGGADKVQVQHMVQHMLKLPAKPQADAADALGVAICHANTNKTLVALAGKASSARKGRYR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.15 | 0.018 | ●●●○○ -2.44 | -2.439522012875611 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)