Bacterial taxon 223926
Locus VP_0428
Protein BAC58691.1
cyclic AMP phosphodiesterase
Vibrio parahaemolyticus RIMD 2210633
Length 268 aa, Gene cpdA, UniProt Q87SJ5
>BAC58691.1|Vibrio parahaemolyticus RIMD 2210633|cyclic AMP phosphodiesterase
MQSSNDSIKLLQITDTHLFAADEGSLLSVKTADSFSAVVNEVLRRKVGFDYILATGDISQDHSAESYQRFADSIAPLQKDCYWLPGNHDYKPNMGSVLPSPQIQAAEHVLLGEKWQLILLDSQVVGVPHGRLSDQQLTLLEEKLTEFPERHTLVLLHHHPLLVGSAWLDQHTLKDAEAFWQVVDRFDNVKGILCGHVHQDMNVIHKGIRVMATPSTCVQFKPNSDDFALDTTSPGWRELELHTNGDITTHVDRLPEGQFQPDFSSNGY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.82 | 0.0036 | ●●●●○ -3.03 | -3.0251354602667377 | 27185914 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)