Bacterial taxon 223926
Locus VP_1601
Protein BAC59863.1
dihydroorotate dehydrogenase
Vibrio parahaemolyticus RIMD 2210633
Length 336 aa, Gene pyrD, UniProt Q87PB7
>BAC59863.1|Vibrio parahaemolyticus RIMD 2210633|dihydroorotate dehydrogenase
MLYRLARTGFFQLDAEKAHDLAIKNFQRFNGTPLDLFYRQQLPNRPVECMGLTFRNPVGLAAGLDKNGECIEAFDAMGFGFVEVGTVTPRPQPGNDKPRLFRLVEAEGIINRMGFNNLGVDHLVENVKKAKFNCVLGINIGKNKDTPIENGAEDYLICMEKVYEYAGYIAVNISSPNTPGLRSLQYGEALDELLSELKAKQSELAEKHGKYVPLALKIAPDLSDDEITQICESLLKNNIDGVIATNTTLDRTVVEGMKHANEAGGLSGRPVQSRSTEVVRKLHEALGDKLPIIGVGGIDSYVAAKEKMMAGAQLVQVYTGFIYHGPGLVRDIVKNL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -5.14 | 5.8e-5 | ●●●●● -4.17 | -4.171103037886344 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)