Bacterial taxon 223926
Locus VP_2442
Protein BAC60705.1
DNA polymerase III, psi subunit
Vibrio parahaemolyticus RIMD 2210633
Length 132 aa, Gene n/a, UniProt Q87M16
>BAC60705.1|Vibrio parahaemolyticus RIMD 2210633|DNA polymerase III, psi subunit
MSINEKQYLHEMGITSWELIHPERLAGYQPPTIDLPSSCKLLLVSPICPTNETAILFEKILKSMKLTLEQAMHIEPERLAMLGEHQLEWVWFAGCESNSMENAKQLTSPLLQDIDGNNEQKRALWQQICSYS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.79 | 0.0002 | ●●●●○ -3.87 | -3.8681384255944273 | 27185914 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)