Bacterial taxon 223926
Locus VP_2845
Protein BAC61108.1
elongation factor P
Vibrio parahaemolyticus RIMD 2210633
Length 188 aa, Gene efp, UniProt Q87KX9
>BAC61108.1|Vibrio parahaemolyticus RIMD 2210633|elongation factor P
MATVSTNEFKGGLKLMLDNEPCVILENEYVKPGKGQAFNRVKIRKLLSGKVLEKTFKSGDTCEVADVMDIDLDYLYSDGEFYHFMNNETFEQIAADAKAVGENAKWLVENNTCMITLWNGNPITVTPPNFVELEVTDTDPGLKGDTQGTGGKPATLATGAVVRVPLFIAIGEVIKVDTRTGEYVGRVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.69 | 0.043 | ●●●○○ -2.04 | -2.040718310035342 | 27185914 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)