Bacterial taxon 223926
Locus VP_0137
Protein BAC58400.1
general secretion pathway protein H
Vibrio parahaemolyticus RIMD 2210633
Length 198 aa, Gene n/a, UniProt Q87TD3
>BAC58400.1|Vibrio parahaemolyticus RIMD 2210633|general secretion pathway protein H
MRKHNGFTLIEILLVLVLLSLTAVAVITTLPTSQKDLSKQYAQSFFQRLQLLNEEAVLSGKDFGVRVDDTKKTYTLLSLTAEGWKPLEMKQIPSKTKLEDDIALQLDLGGGAWDKDDRLFEPGSLFEEMFADETEEKKVKPPQVFIFSSAEVTPFTLSFFPQKGDAFNDGWRVIGKESGQILLVAPGEEVEEDANAQF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.86 | 0.0033 | ●●●●○ -3.06 | -3.056694226780452 | 27185914 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)