Bacterial taxon 223926
Locus VP_0142
Protein BAC58405.1
general secretion pathway protein M
Vibrio parahaemolyticus RIMD 2210633
Length 164 aa, Gene n/a, UniProt Q87TC8
>BAC58405.1|Vibrio parahaemolyticus RIMD 2210633|general secretion pathway protein M
MMKNLISQAQAWWSGISQREQRLVLGCGAFAILGILYWGLLQPMSQRAELAQSRIQSEKQLLTWVQDKADDITALRKSGGVSFSNQPLNQLVSSSARRFKVELIRVQPRNDSVQVWIKPLAFNQLVDWLRYLKEQQGIEVEFLDIDRTDQAGMIDVNRLQFKRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.18 | 0.0013 | ●●●●○ -3.34 | -3.3359821214480614 | 27185914 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)