Bacterial taxon 223926
Locus VPA_0285
Protein BAC61628.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 36 aa, Gene n/a, UniProt Q87JG8
>BAC61628.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MIENFIWFDKKFLLNFPLELQFFDLIIFIENEQTTR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.18 | 0.049 | ●●●○○ -2.15 | -2.147765703230708 | 27185914 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)