Bacterial taxon 223926
Locus VPA_0319
Protein BAC61662.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 43 aa, Gene n/a, UniProt Q87JD4
>BAC61662.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MLIEDYNTILYTVQNKINGTGNTNEQDTYRTTNFGSSWHRNGR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2,39 | 0,0012 | ○○○○○ 3,46 | 3.4565088517934277 | 27185914 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)