Bacterial taxon 223926
Locus VPA_0644
Protein BAC61987.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 34 aa, Gene n/a, UniProt Q87IG2
>BAC61987.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MREWHDYENQTVSDDFICSVGGFELARNAKKASI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.22 | 0.043 | ●●●○○ -2.2 | -2.20226474657675 | 27185914 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)