Bacterial taxon 223926
Locus VPA_1225
Protein BAC62568.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 51 aa, Gene n/a, UniProt Q87GU0
>BAC62568.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MFINAKCYPLIDNNRRRKTHPYPLNNPFMVQIFSSSLPSSDPTKGQFVSEI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.72 | 0.0092 | ●●●○○ -2.82 | -2.818185820806648 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)