Bacterial taxon 223926
Locus VPA_1343
Protein BAC62686.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 97 aa, Gene n/a, UniProt Q87GH3
>BAC62686.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MLSNAGAGARALGDFAQDGALKTTEVGVSFESLIKEADKDVEKFIHDKAGTNGRLELSAGESLQLQRLMGDQSITVQTGTATLKSIKDSISSAARNI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.73 | 0.00014 | ●●●●● -4.05 | -4.0487207123149656 | 27185914 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)