Bacterial taxon 223926
Locus VPA_1368
Protein BAC62711.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 85 aa, Gene n/a, UniProt Q87GE8
>BAC62711.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MFDNGILGLQGVDVTQPSVMEKTYNNVGESFEQILATIDSIGDGMSAVDALRLQQEVFHYSIYQETVTKIASKAATAVNEVMKAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.59 | 0.015 | ●●●○○ -2.65 | -2.650041021630028 | 27185914 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)