Bacterial taxon 223926
Locus VPA_1688
Protein BAC63031.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 30 aa, Gene n/a, UniProt Q87FJ1
>BAC63031.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MNFLHFSKDKLALQSPISPNIMNLNNLMLC
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2,28 | 0,002 | ○○○○○ 3,32 | 3.322775541338365 | 27185914 |
Retrieved 1 of 1 entries in 0,9 ms
(Link to these results)