Bacterial taxon 223926
Locus VP_0759
Protein BAC59022.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 47 aa, Gene n/a, UniProt Q87RL9
>BAC59022.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MKQCLDGANMTNFFRSKKLSQQQSEQVQNEKIKNNINPYFSITYIDK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.02 | 0.042 | ○○○○○ 2.05 | 2.052757899970046 | 27185914 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)