Bacterial taxon 223926
Locus VP_1509
Protein BAC59772.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 209 aa, Gene n/a, UniProt Q87PJ3
>BAC59772.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MATSFLSRWSKRKLEESSQHDEEITPIAETEQSEDCVTALSNADESSDALNVNEVSQSPDITASVETEKPEEMSVAQLLVSEASESVKKAALRKMFLSEEFNVRDGLDDYDDDYSNLKSLSKDVAETLRDWVKEKVEEEPDAATTQGSELNADDIASEVVEDTEPNAEKSAGITQDENELYINTVPGKGDTFAEESPPNEVRQNIPHKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.76 | 0.038 | ●●●○○ -2.1 | -2.1039723060453377 | 27185914 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)