Bacterial taxon 223926
Locus VP_1581
Protein BAC59845.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 42 aa, Gene n/a, UniProt Q877N6
>BAC59845.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MLRFTSASISWVILSMVLIGLSFYLVAEIVVASNIPNGLNQS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.1 | 0.037 | ○○○○○ 2.12 | 2.1206046460942276 | 27185914 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)