Bacterial taxon 223926
Locus VP_1884
Protein BAC60147.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 61 aa, Gene n/a, UniProt Q87NI4
>BAC60147.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MYPACYELISLGVYHFRQFSFDGFKIIYQYDEEANKIYALVQISDRQGLQKTLVDYCIRFL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 3.22 | 0.0029 | ○○○○○ 3.1 | 3.097364706852964 | 27185914 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)