Bacterial taxon 223926
Locus VP_1104
Protein BAC59367.1
leucine-responsive regulatory protein
Vibrio parahaemolyticus RIMD 2210633
Length 164 aa, Gene n/a, UniProt Q87QP5
>BAC59367.1|Vibrio parahaemolyticus RIMD 2210633|leucine-responsive regulatory protein
MADNYKKPSKELDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGYITGYTALLNPQFLDASLLVFVEITLNRGAPDVFEQFNSAVQKLDDIQECHLVSGDFDYLLKTRVSDMGAYRRLLGDTLLRLPGVNDTRTYVVMEEVKQSNQLVIKTR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.26 | 0.014 | ●●●○○ -2.54 | -2.5367106997320663 | 27185914 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)