Bacterial taxon 223926
Locus VP_0001
Protein BAC58264.1
MioC protein
Vibrio parahaemolyticus RIMD 2210633
Length 144 aa, Gene n/a, UniProt Q87TR7
>BAC58264.1|Vibrio parahaemolyticus RIMD 2210633|MioC protein
MIHIITGSTLGGAEYVGDHLSDLLVEQGFETTIHNQPSLDEIDNQGTWLVITSTHGAGEYPDNIQPFIAALQNTPPKMADVKFAVIAIGDSSYDTFCAAGKHAYNLLEDIGATPIADCLLIDVLAHDVPEDAAEAWLKENIERF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.01 | 0.024 | ●●●○○ -2.32 | -2.3158324633832206 | 27185914 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)