Bacterial taxon 223926
Locus VP_0520
Protein BAC58783.1
MutT/nudix family protein
Vibrio parahaemolyticus RIMD 2210633
Length 174 aa, Gene rppH, UniProt Q87SA4
>BAC58783.1|Vibrio parahaemolyticus RIMD 2210633|MutT/nudix family protein
MIDGDGYRLNVGIVICNNHGQVFWAKRYGQHSWQFPQGGIDEGETPEQAMFRELYEEVGLTKKDVKIIATSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLRLECDESRINMQRGKSPEFDGWRWVSYWYPVRQVVSFKRDVYRRAMKEFASLAMPFRERKTKGKRKKQQRRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.44 | 0.0092 | ●●●○○ -2.7 | -2.696608671904209 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)